SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027400 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027400
Domain Number 1 Region: 184-259
Classification Level Classification E-value
Superfamily Homeodomain-like 7.27e-23
Family Homeodomain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027400   Gene: ENSGGOG00000023318   Transcript: ENSGGOT00000023743
Sequence length 270
Comment pep:novel chromosome:gorGor3.1:2b:64136870:64137828:-1 gene:ENSGGOG00000023318 transcript:ENSGGOT00000023743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALPWAATPASCAP
AQPAGATAFGGFSQPYMAGSGPLGLQPPTAKDGPEEQAKFYAPEAAAGPEERGRTRPSFA
PESSLAPAVAALKAAKYDYAGVGRATPGSTTLLQGAPCAPGFKDDTKGPLNLNMTVQAAG
VASCLRPSLPDGLPWGAAPGRARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLN
LSDQQVKIWFQNRRMKKKRVVLREQALALY
Download sequence
Identical sequences G3QG72
ENSGGOP00000001324 ENSGGOP00000027400 XP_004032882.1.27298 XP_004032888.1.27298 ENSGGOP00000001324 ENSGGOP00000027400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]