SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027405 from Gorilla gorilla 76_3.1

(show help)
Strong hits

Sequence:	ENSGGOP00000027405
Domain Number 1	Region: 128-200
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	7.23e-19
Family	Complement control module/SCR domain	0.0000225
Further Details:

Domain Number 2	Region: 189-250
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	2.75e-16
Family	Complement control module/SCR domain	0.0000118
Further Details:

Domain Number 3	Region: 64-138
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.0000000000111
Family	Complement control module/SCR domain	0.0000313
Further Details:

Domain Number 4	Region: 2-68
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.0000000000189
Family	Complement control module/SCR domain	0.0000205
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSGGOP00000027405 Gene: ENSGGOG00000022844 Transcript: ENSGGOT00000032478
Sequence length	347
Comment	pep:known_by_projection chromosome:gorGor3.1:1:187315195:187355815:1 gene:ENSGGOG00000022844 transcript:ENSGGOT00000032478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEEGFVKIPGEKDSVICLKGSQWSDIEEFC NRNCEVPTRLNSASLKQPYITQNYFPVGTIVEYECRPGYMREPSLSTKLTCLQNLKWSTA VEFCKKKSCPNPGEIRNGQIDVPSGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWS DPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSITYACNKGFTMIGEHSIYCTVNNDEG EWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVS RTTKHFHETTPNKGNGTTSGQLILFSWHTCFTLTGLLGMLVTMGLPT
Download sequence
Identical sequences	ENSGGOP00000027405

SEARCH