SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027442 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027442
Domain Number 1 Region: 568-685
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-25
Family PDZ domain 0.0021
Further Details:      
 
Domain Number 2 Region: 440-552
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-24
Family PDZ domain 0.0053
Further Details:      
 
Domain Number 3 Region: 224-317
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-22
Family PDZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 328-426
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-21
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 42-95
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000137
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027442   Gene: ENSGGOG00000016167   Transcript: ENSGGOT00000031773
Sequence length 690
Comment pep:known_by_projection chromosome:gorGor3.1:13:9377998:9453697:-1 gene:ENSGGOG00000016167 transcript:ENSGGOT00000031773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTTSDEMVSVEQTSSSSLNPLCFECGQQHWTRENHLYNYQNEVDDDLVCHICLQPLLQP
LDTPCGHTFCYKCLRNFLQEKDFCPLDRKRLHFKLCKKSSILVHKLLDKLLVLCPFSSVC
KDVMQRCDLEAHLKNRCPGASHRRVALERRKTSRTQAEIENENGPTLLDPAGTLSPEADC
LGTGAVPVERHLTSASLPTWSEEPGLDNPAFEESAGADTTQQPLSLPEGEITTIEIHRSN
PYIQLGISIVGGNETPLINIVIQEVYRDGVIARDGRLLAGDQILQVNNYNISNVSHNYAR
AVLSQPCNTLHLTVLRERRFGNRAHNHSDSNSPREEIFQVALHKRDSGEQLGIKLVRRTD
EPGVFILDLLEGGLAAQDGRLSSNDRVLAINGHDLKHGTPELAAQIIQASGERVNLTIAR
PGKPQPGNTIREAGNHSSSSQHHTPPPYYSRPSSHKDLTQCVTCQEKHITVKKEPHESLG
MTVAGGRGSKSGELPIFVTSVPPHGCLARDGRIKRGDVLLNINGIDLTNLSHSEAVAMLK
ASAASPAVALKALEVQIVEEATQNAEEQPSTFSENEYDASWSPSWVMWLGLPSTLHSCHD
IVLRRSYLGSWGFSIVGGYEENHTNQPFFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTV
GMSHSALVPMLKEQRNKVTLTVICWPGSLV
Download sequence
Identical sequences ENSGGOP00000015774 ENSGGOP00000015774 ENSGGOP00000027442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]