SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027491 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027491
Domain Number 1 Region: 1640-1942
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.66e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000301
Further Details:      
 
Domain Number 2 Region: 4-260
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.49e-72
Family Carbonic anhydrase 0.00000991
Further Details:      
 
Domain Number 3 Region: 1942-2226
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.06e-71
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000138
Further Details:      
 
Domain Number 4 Region: 272-370
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000143
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027491   Gene: ENSGGOG00000023127   Transcript: ENSGGOT00000026782
Sequence length 2259
Comment pep:known_by_projection chromosome:gorGor3.1:7:119954589:120049131:1 gene:ENSGGOG00000023127 transcript:ENSGGOT00000026782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GALNNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGK
TVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDA
DRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNL
LPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDY
LQNNFREQQYKFSRQVFSSYTGKEEIHEAEVCSSEPENVQADPENYTSLLVTWERPRVVY
DTMIEKFAVLYQQLDGEDQTKHEFLTDGYQDLGAILNNLLPNMSYVLQIVAICTNGLYGK
YSDQLIVDMPTDNPELDLFPELIGTEEIIKEEEEGKDIEEGAIVNPGRDSATNQIRKKEP
QISTTTHYNRIGTKYNEAKTNRSPTRGSEFSGKGDVPNTSLNSTSQPVTKLATEKDISLT
SQTVTELPPHTVEGTSASLNDGSKTVLRSPHMNLSGTAESLNTVSITEYEEESLLTSFKL
DTGAEDSSGSSPATSAIPFISENISQGYIFSSENPETITYDVLIPESARNASEDSTSSGS
EESLKDPSMEGNVWFPSSTDVTAQPDVGSGRESFLQTNYTEIRVDESEKTTKSFSTGPVM
SQGPSATDLEMPHYSTFAYFPTEVTPHAFTPSSRQQDLVSMVNVVHSQTTQPVYNGETPL
QPSYSSEVFPLVTPLLLDNQILNTTPAASSSDSALHATPVFPSVDVSFESILSSYDGAPL
LPFSSASFSSELFRHLHTVSQILPQVTSATESDKVPLHASLPVAGGDLLLEPSLAQYSDV
LSTTHAASETLEFGSESGVLYKTLMFSQVEPPSSDAMMHARSSGPEPSYALSDNEGSQHI
FTVSYSSAIPVHDSVGVTYQGSLFSGPSHIPIPKSSLITPTASLLQPTHAFSGDGEWSGA
SSDSEFLLPDTDGLTALNISSPVSVAEFTYTTSVFGDDNKAISKSEIIYGNETELQIPSF
NEMVYPSESTVMPNMYDNVNKLNASLQETSVSISSTKGMFLGSLAHTTTKVFDHEISQVP
ENNFSVQPTHTVSQASGDTSLKPVFSANSEPASSDPASSEMLSPSTQLLFYETSASFSTE
VLLQPSFQASDVDTLLKTVLPAVPSDPILVETPKVDKISSTMLHLIVSNSASSENMLHST
SVPVFDVSPTSHMHSASLQGLTISYASEKYEPVLFKSESSHQVVPSLYSNDELFQTANLE
INQAHPPKGRHAFATPVVSIDEPLNTLINKLIHSDEILTSTKSSVTGKVFAGIPTVASDT
FVSTDHSVPIGNGHVAITAVSPNRDGSVTSTKLLFPSKATSELSHSAKSDADLVGDSDGL
SIHKCMSCSSYRESQEKVMNDSDTHENSLTDQNNAILYSLSENSEEDNRVTSVSSDSQTG
MDRSPGKSPSANGLSQKHNDGKEENDIQTGSALLPLSPESKAWAVLTSDEESGSGQGTSD
SLNENETSTDFSFADTNEKDADGILAAGDSEITPGFPQSPTPSVTSENSEVFHVSETTEA
SNSSHESRIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAHFYLEDS
TSPRVISTPPTPIFPISDDVGAIPIKHFPKHVADLHASSGFTEEFETLKEFYQEVQSCTV
DLGITADSSNHPDNKHKNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKA
YIAAQGPLKSTAEDFWRMIWEDNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQ
KSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVR
KAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLV
QTEEQYVFIHDTLVEAILSKETEVLDSHIHAYVNALLIPGPAGKTKLEKQFQLLSQSNIQ
QSDYSAALKQCNREKNRTSSIIPVERSRVGISSLSGEGTDYINASYIMGYYQSNEFIITQ
HPLLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKDEPINCESFKVTLMAEEH
KCLSNEEKLIIQDFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRD
GPMIVHDEHGGVTAGTFCALTTLMHQLEKENSVDVYQVAKMINLMRPGVFADIEQYQFLY
KVILSLVSTRQEENPSTSLDSNGAALPDGNIAESLESLV
Download sequence
Identical sequences ENSGGOP00000027491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]