SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027513 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027513
Domain Number 1 Region: 1275-1437,1465-1544
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-39
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 774-1001
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-38
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 1598-1849
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.68e-35
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 95-252,353-420
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.67e-32
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027513   Gene: ENSGGOG00000014033   Transcript: ENSGGOT00000027369
Sequence length 2292
Comment pep:known_by_projection chromosome:gorGor3.1:16:1231176:1307263:1 gene:ENSGGOG00000014033 transcript:ENSGGOT00000027369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGPRAADEVRVPLGAPPPGPAALVGASPESPGAPGREAERGSELGVSPPRAXELGADE
EQRVPYPALAATVFFCLGQTTRPRSWCLRLVCNPYWFEHVSMLVIMLNCVTLGMFRPCED
VECGSERCNIAEAFDAFIFAFFAVEMVIKMVALGLFGQKCYLGDTWNRLDFFIVVAGMME
YSLDGHNVSLSAIRTVRVLRPLRAINRVPSLRILVWLMVETLLPAWSHLLKLCFFVFFIF
GIVGVQLWAGLLRNRCFLDSAFVRNNNLTFLRPYYQTEEGEENPFICSSRRDNGMQKCSH
IPGRRELRVPCTLGWEAYTQPQAEGVGAARNACINWNQYYNVCRSGDSNPHNGAINFDNI
GYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSE
TKQRESQLMREQRARHLSNDSTLASFSEPGSCYEELLKYVGHIFRKVKRRSLRLYARWQS
RWRKKVDPSAVQGQGPGHRQRRAGRHTASVHHLVFSHSSPRRPGPEPGACDTRLVRAGAP
PSPPSPGRGPPDAESVHSIYHADCHIEGPQERARVAHAAATAAASLKLATGLGTMNYPTI
LPSGVGSGKGSTSPGPKGKWAGGPPRTGGHSLLSLNSPDPYENIQHVVGEHGLGQAPGHL
SGLSVPCPLPSPPAGTLTCELKSCPYCTRALEDPEGELSGSESGDSDGRGVYEFTQDVRH
GDRRDPTQPHPATDTPGPGSPRRRAQQRAAPGEPGWMGRLWVTFSGKLRRIVDSKYFSRG
IMMAILVNTLSMGVEYHEQPEELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYN
IFDGIIVVISVWEIVGQADGGLSVLRTFRLLRVLKLVRFLPALRRQLVVLVKTMDNVATF
CTLLMLFIFIFSILGMHLFGCKFSLKTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNV
VLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSDTDEDKTSVHF
EEDFHKLRELQTTELKMCSLAVTPNGHLEGRGSLSPPLIMCTAATPMPTPKSSPFLDAVP
SLPDSRRGSSSSGDPPLGDQKPPASLRSSPCAPWGPNGAWSSRRSSWSSLGRAPSLKRRS
QCGERESLLSGEGKGSTDDEAEDGRATPGPRATPLRRAESLDPRPLRPATLPPTKCRDRN
GQMVALPSDFFLRIDSHREDAAELDDDSEDSCCLRLHKVLEPYKPQWCRSREAWALYLFS
PQNGFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDPGSTERVFLSVSNYIFTAI
FVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGAKILGVLRVL
RLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYY
CEGSDTRNISTKAQCRAAHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVG
VDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRL
RRLERRRRSTLPSPEAQRRPYYADYSPTRRSIHSLCTSHYLDIFITFIICVNVITMSMEH
YNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSLMGITL
EEIEMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFML
LFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTL
RECSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDA
EIELEMAQGPGSARRVDVDRPPSPQESPGARDAPNLLVARKVSVSRMLSLPNDSYMFRPV
VPASVPHPRPLQEVEMETYGAGTPLGSVASVHSPPAESCASLQIPLAVSSPARSGEPLHA
LSPRGTARSPSLSRLLCRQEAVHTDSLEGKIDIPRDTLDPAEPGEKTPVRPVTQGGSLQS
PPRSPRPASVRTRKHTFGQRCVSSRPAAPGGEEAEASDPADEEVSHITSXEQWRPSAELG
SGEPGEAKAWGPEAEPALGARRKKKMSPPCISVEPPAEDEGSARPPAAEGGSTTLRRRTP
SCEATPHRDSLEPTEGSGAGGDPAAKGERWGQASCRAEHLTVPSFAFEPLDLGVPSGDPF
LDGSHSVTPESRASSSGAIVPLEPPESEPPMPVGDPPEKRRGLYLTVPQCPLEKPGSPSA
TPAPGGGADDPV
Download sequence
Identical sequences ENSGGOP00000027513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]