SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027515 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027515
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 8.88e-25
Family Cofilin-like 0.00000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027515   Gene: ENSGGOG00000025201   Transcript: ENSGGOT00000029779
Sequence length 124
Comment pep:novel chromosome:gorGor3.1:5:59105270:59105644:-1 gene:ENSGGOG00000025201 transcript:ENSGGOT00000029779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATKVDKEACWEAYNLARDDGLAVIWVTFKYDGSTIVRIGQGVEYQHFIPQCTDEIWLLA
FVCVTTRDATLITWIGENVKTLVKEVIQDFTKEFVISDQKELEGDLMKSELKKTGGINYN
AQME
Download sequence
Identical sequences ENSGGOP00000027515 XP_004042156.1.27298 ENSGGOP00000027515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]