SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027521 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027521
Domain Number 1 Region: 148-259
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-37
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 2 Region: 78-162
Classification Level Classification E-value
Superfamily PDZ domain-like 8.94e-23
Family PDZ domain 0.00045
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027521
Domain Number - Region: 296-395
Classification Level Classification E-value
Superfamily PH domain-like 0.005
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027521   Gene: ENSGGOG00000007727   Transcript: ENSGGOT00000029105
Sequence length 499
Comment pep:known_by_projection chromosome:gorGor3.1:16:59367773:59484433:1 gene:ENSGGOG00000007727 transcript:ENSGGOT00000029105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELE
PALGPTAAAFNGLPMRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGD
AILSVNGTDLRQATHDQAVQALKRAGKEVLLEIKFIREVTPYIKKPSLVSDLPWEGAAPQ
SPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSMPDLENRLIELHSPDSRNTLILR
CKDTATAHSWFVAIHTNIMALLPQVLAELNAMLGATSTAGGSKEVKHIAWLAEQAKLDGG
RQQWRPVLMAVTEKDLLLYDCMPWTRDAWASPCHSYPLVATRLVHSGSGCRSPSLGSDLT
FATRTGSRQGIEMHLFRVETHRDLSSWTRILVQGCHAAAELIKEVSLGCMLNGQEVRLTI
HYENGFTISRENGGSSSMLYRYPFERLKMSADDGIRNLYLDFGGPEGELTMDLHSCPKPI
VFVLHTFLSAKVTRMGLLV
Download sequence
Identical sequences ENSGGOP00000027521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]