SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027528 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027528
Domain Number 1 Region: 183-253
Classification Level Classification E-value
Superfamily Homeodomain-like 5.99e-18
Family Homeodomain 0.0000547
Further Details:      
 
Domain Number 2 Region: 54-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-16
Family LIM domain 0.022
Further Details:      
 
Domain Number 3 Region: 22-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000158
Family LIM domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027528
Domain Number - Region: 117-143
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00295
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027528   Gene: ENSGGOG00000024385   Transcript: ENSGGOT00000034752
Sequence length 363
Comment pep:known_by_projection chromosome:gorGor3.1:15:55981962:55987651:1 gene:ENSGGOG00000024385 transcript:ENSGGOT00000034752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVC
SRQLLPGDEFSLREHELLCRADHGLLLLPGKRAGACAGVVIGLQHRSADQAGPLDAGSGR
QPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIR
VWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQT
YQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSP
VET
Download sequence
Identical sequences ENSGGOP00000027528 ENSGGOP00000025579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]