SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027537 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027537
Domain Number 1 Region: 460-687
Classification Level Classification E-value
Superfamily Folate-binding domain 1.05e-43
Family Aminomethyltransferase folate-binding domain 0.00036
Further Details:      
 
Domain Number 2 Region: 3-183,288-323
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-30
Family FAD-linked reductases, N-terminal domain 0.0011
Further Details:      
 
Domain Number 3 Region: 185-287
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.49e-19
Family L-aminoacid/polyamine oxidase 0.046
Further Details:      
 
Domain Number 4 Region: 689-782
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000000000196
Family Aminomethyltransferase beta-barrel domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027537   Gene: ENSGGOG00000009314   Transcript: ENSGGOT00000026820
Sequence length 803
Comment pep:known_by_projection chromosome:gorGor3.1:16:60325733:60355842:1 gene:ENSGGOG00000009314 transcript:ENSGGOT00000026820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLAAGSTRFCAGILSTARHLTIEQKMADYSNKLYHQLEQETGIQTGYTRTGSIFLAQTQD
RLISLKRINAGLNVIGIPSEIISPKKVAGLHHLLNVHDLVGAMHVPEDAVVSSADVALAL
ASAASQNGVQIYDRTSVLHVMVKKGQVTGVETDKGQIECQYFVNCAGQWAYELGLSNEEP
VSIPLHACEHFYLLTRPLETPLQSSTPTIVDADGRIYIRNWQGGILSGGFEKNPKPIFTE
GKNQLEIQNLQEDWDHFEPLLSSLLRRMPELETLEIMKLVNCPETFTPDMRCIMGESPAV
QGYFVLAGMNSAGLSFGGGAGNMLRLIRRYISQTSFYLKIRHYRVLPSSNTYLNQKMLSH
SPLSFFFPTPKNVFQDVGHQLNKRTLQEKDRMALPLSWAGSCPLKPPKWRSPGDTPSCHF
AGVVYSGRHFIVFDTKVGPCGPARCSHAHSLFHSLTLQSTGDQALEVLQYLFSNDLDVPV
GHIVHTGMLNEGGGYENDCSIARLNRRSFFMISPTDQQVHCWAWLKKHMPKDSNLLLEDV
TWKYTGTGVRVLPRRKDVISDLYAYCKQIHNFSFLCSIVTVIGFLNDDEIGHLPNGERAS
INYYLRIAYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFAFWGQDINNLTTPLECG
RESRVKLEKGMDFIGRDALLQQKQNGVYKRLTMFILDDHDTDLDLWPWWGEPIYRNGQYV
GKTTSSAYSYSLERHVCLGFVHNFSEDTGEEQVVTADFINRGEYEIDIAGYRFQAKAKLY
PVASLFTQKRRKDDMELSDLHGK
Download sequence
Identical sequences ENSGGOP00000009100 ENSGGOP00000027537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]