SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027538 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027538
Domain Number 1 Region: 15-145
Classification Level Classification E-value
Superfamily Cupredoxins 3.83e-40
Family Ephrin ectodomain 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027538   Gene: ENSGGOG00000002341   Transcript: ENSGGOT00000022131
Sequence length 183
Comment pep:known_by_projection chromosome:gorGor3.1:19:1265938:1279949:1 gene:ENSGGOG00000002341 transcript:ENSGGOT00000022131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSRAEEAARANSGRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLP
PAERMEHYVLYMVNGEGHASCDHRQRGFKRWECIKFSEKFQLFTPFSLGFEFRPGHEYYY
ISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTL
LGS
Download sequence
Identical sequences ENSGGOP00000027538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]