SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027549 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027549
Domain Number 1 Region: 74-259
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.04e-48
Family Astacin 0.00023
Further Details:      
 
Domain Number 2 Region: 430-599
Classification Level Classification E-value
Superfamily TRAF domain-like 7.36e-39
Family MATH domain 0.00087
Further Details:      
 
Domain Number 3 Region: 268-431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-28
Family MAM domain 0.0055
Further Details:      
 
Domain Number 4 Region: 672-714
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family EGF-type module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027549   Gene: ENSGGOG00000007628   Transcript: ENSGGOT00000030182
Sequence length 746
Comment pep:known_by_projection chromosome:gorGor3.1:6:48258445:48304316:1 gene:ENSGGOG00000007628 transcript:ENSGGOT00000030182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWIRSTCILFFTLLFAHIAAVPIKYLPEENVHDADFGEQKDISEINLAAGLDLFQGDIL
LQKSRNGLRDPNTRWTFPIPYILADNLGLNAKGAILYAFEMFRLKSCVDFKPYEGESSYI
IFQQFDGCWSEVGDQHVGQNLSIGQGCAYKAIIEHEILHALGFYHEQSRTDRDDYVNIWW
DQILSGYQHNFDTYDDSLITDLNTPYDYESLMHYQPFSFNKNASVPTITAKIPEFNSIIG
QRLDFSAIDLERLNRMYNCTTTHTLLDHCTFEKANICGMIQGTRDDTDWVHQDSAQAGEV
DHTLLGQCTGAGYFMQFSTSSGSAEEAALLESRILYPKRKQQCLQFFYKMTGSPSDRLVV
WVRRDDSTGNVRKLVKVQTFQGDDDHNWKIAHVVLKEEQKFRYLFQGTKGNPQNSTGGIY
LDDITLTETPCPTGVWTVRNFSQVLENTSKGDKLQSPRFYNSEGYGFGLTLYPNGRESSG
YLRLAFHVCSGENDAILEWPVENRQVIITILDQEPDVRNRMSSSMVFTTSKSHTSPAIND
TVIWDRPSRVGTYHTDCNCFRSIDLGWSGFISHQMLKRRSFLKNDDLIIFVDFEDITHLS
QTEVPTKGKRLSPQGLILQGQEQQVSEEGLGKAMLEEALPVSLSQGQPSRQKRSVENTGP
LEDHNWPQYFRDPCDPNPCQNDGICVNVKGMASCRCISGHAFFYTGERCQAVQVHGSVLG
MVIGGTAGVIFLTFSIIAILSQRPRK
Download sequence
Identical sequences G3SHG1
ENSGGOP00000007466 ENSGGOP00000027549 XP_004044191.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]