SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027568 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027568
Domain Number 1 Region: 137-357
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.58e-59
Family Voltage-gated potassium channels 0.00057
Further Details:      
 
Domain Number 2 Region: 5-101
Classification Level Classification E-value
Superfamily POZ domain 4.71e-26
Family Tetramerization domain of potassium channels 0.00000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027568   Gene: ENSGGOG00000025596   Transcript: ENSGGOT00000025275
Sequence length 410
Comment pep:novel chromosome:gorGor3.1:12:4934698:4936186:1 gene:ENSGGOG00000025596 transcript:ENSGGOT00000025275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGLLERLVINISGLRFETQLRTLSLFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAI
LYYYQSGGRLRRPVNVPLDIFLEEIRFYQLGDEALAAFREDEGCLVANEKPLPSQPFQRQ
VWLLFEYPESSAGQGLAIVSVLVILISIVIFCLETLPQFRFTDPFFLVETLCIVWFTFEL
LVRFSACPSKPAFFRNIMNIIDLVAIFPYFITLGTELVQQRGGGQNGQQAMSLAILRVIR
LVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSL
FPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY
HRETEQEEASIPSHVQCAGPEGNDNGRLTGNGQLPSPHRAYAEKRMLTEV
Download sequence
Identical sequences ENSGGOP00000027568 ENSGGOP00000027568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]