SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027605 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027605
Domain Number 1 Region: 154-231
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.06e-18
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027605   Gene: ENSGGOG00000022497   Transcript: ENSGGOT00000025493
Sequence length 231
Comment pep:novel chromosome:gorGor3.1:17:17352329:17353088:-1 gene:ENSGGOG00000022497 transcript:ENSGGOT00000025493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFKTIEDLRVQIFASTVDSACIILQIDKAHIAADDFRVKCETELAMCQSVESDIHGLRKT
TDDTNVTQLQLETEIEALKEELLFMKKTHEEEVKGLQAQIASSGLTMEVDALKSQDMAKI
MADIHAQYDKGAEQIGASEIMLMEMRHTLQFLEINLNSMRNLKARLENSLREVETRYGMQ
MEQLNRVLLHLKLELAQTWAEGQHQVQEYEALLNIKIKLEAEITTYHHLLE
Download sequence
Identical sequences ENSGGOP00000027605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]