SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027659 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027659
Domain Number 1 Region: 56-154
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-28
Family C-type lectin domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027659   Gene: ENSGGOG00000022960   Transcript: ENSGGOT00000030545
Sequence length 156
Comment pep:known_by_projection chromosome:gorGor3.1:12:7935436:7952525:-1 gene:ENSGGOG00000022960 transcript:ENSGGOT00000030545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKGLWWFQLKVWSMAVVSILLLSVCFTVSSVVPHNFMYSKTVKRLSKLREYQQYHPSLTC
VMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFI
IQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVT
Download sequence
Identical sequences ENSGGOP00000027659 ENSGGOP00000027659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]