SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027671 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027671
Domain Number 1 Region: 279-450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-44
Family SPRY domain 0.00017
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-16
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 85-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000336
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027671
Domain Number - Region: 165-248
Classification Level Classification E-value
Superfamily NAP-like 0.0366
Family NAP-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027671   Gene: ENSGGOG00000024492   Transcript: ENSGGOT00000028982
Sequence length 452
Comment pep:novel chromosome:gorGor3.1:11:87122034:87148315:-1 gene:ENSGGOG00000024492 transcript:ENSGGOT00000028982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGILQVFQRELICPMCMNYFVDPVTTDCGHSFCRPCFYLNWQDIPFLVQCSECTKSTE
QINLQTDIHLKKMASLARKVSLWLFLSSEEQMCGTHRETKKMFCEVDRSLLCLLCSSSQE
HRYHRHRPIEWAAEEHREKLLQKMQSLWEKACENHRNLNVESTRTRCWKDYMNLRLEAIR
AEYEKMAAFHHEEEKHNLEMLKKKGKDIFHRLHLSKAKMAHRREILRGMYEELNEMCHKP
DVELLQAFGDILHRSESVLLHMPQPLNPELSAGPITGLRDRLNQFRVHITLHHEEANSDI
FLYEILRSMCIGCDHQDVPYFTATPRSFLAWGAQTFTSGKYYWEVHVGDSWNWAFGVCNK
YWKEKNQNEKIDGEEGLFLLGCVKNDIQRSLFTTSPLMLQYIPRPTSRVGLFLDCEAKTV
SFVDVNQSSLIYTIPNCSFSPPLRPIFCCIHF
Download sequence
Identical sequences G3RMQ7
ENSGGOP00000027671 XP_004052002.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]