SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027711 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027711
Domain Number 1 Region: 152-349
Classification Level Classification E-value
Superfamily E set domains 5.6e-81
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000989
Further Details:      
 
Domain Number 2 Region: 38-168
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.05e-23
Family Voltage-gated potassium channels 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027711   Gene: ENSGGOG00000000554   Transcript: ENSGGOT00000031593
Sequence length 437
Comment pep:known_by_projection chromosome:gorGor3.1:22:22779453:22780790:-1 gene:ENSGGOG00000000554 transcript:ENSGGOT00000031593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM
IFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVGGGGAAPVAPKPCIMHVNGFLGAFLFS
VETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFS
HHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQRDLNVGYDI
GLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTTQARSSYL
ASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITVLPAPPPPP
SAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERM
QASLPLDNISYRRESAI
Download sequence
Identical sequences ENSGGOP00000027711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]