SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027725 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027725
Domain Number 1 Region: 221-243
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000017
Family CCCH zinc finger 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027725   Gene: ENSGGOG00000012514   Transcript: ENSGGOT00000026934
Sequence length 943
Comment pep:known_by_projection chromosome:gorGor3.1:16:79224670:79290008:1 gene:ENSGGOG00000012514 transcript:ENSGGOT00000026934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVAESPERDPHSPEDEEQPQGLSDDDILRDSGSDQDLDGAVVRASDLEDEESAARGPSQ
EEEDNHSDEEDRASEPKSQDQDSEVNELSRGPTSSPCEEEGDEGEDDRTSDLRDEASSVT
RELDEHELDYDEEVPEEPAPAVQEDEAEKAGAEDDEEKGEGAPREEGKAGVPSVGEKESL
EAAKEKKKEDDDGEIDDGEIDDDDLEEGEVKDPSDRKVRPRPTCRFFMKGNCTWGMNCRF
IHPGVNDKGNYSLITKADPFPPNGAPPLGPHPLMPANPWGGPVVDEILPPPPPEPPTESA
WERGLRHAKEVLKKATIRKEQEPDFEEKRFTVTIGEDEREFDKENEVFRDWNSRIPRDVR
DTVLEPYADPYYDYEIERFWRGGQYENFRVQYTETEPYHNYREPIRVSSQRVPWKVGESP
RDPFPLRSSLLCPREGQQGGSGCTLHLPSRGLKPETHQAKRDEKDRQHRDRDPKPRSPQP
PSRQAEPPKKEAATAGPQVKRADEWKDPWRRSKSPKKKLGVSVSPSRARRRRKTSASSAS
ASNSSRSSSRSSSYSGSGSSRSRSRSSSYSSYSSRSSRHSSFSGSRSRSRSFSSSPSPSP
TPSPHRPSIRTKGEPAPPPGKAGEKAVKKPAPPPAPPQATKTTAPVPEPTKPGDPREARR
KERPARTPPRRRTLSGSGSGSGSSYSGSSSRSRSLSVSSVSSVSSATSSSSSAHSVDSED
MYADLASPVSSASSRSPAPAQTRKEKGKSKKEDGVKEEKRKRDSSTQPPKSAKPPAGGKS
SQQPSTPQQAPPGQPQQGTFVAHKEIKLTLLNKAADKGSRKRYEPSDKDRQSPPPAKRAN
TSPDRGSRDRKSGGRLGSPKPERQRGQNSKAPAAPADRKRQLSPQSKSSSKVTSVPGKAS
DPGTASTKSGKASTLSRREELLKQLKAVEDAIARKRAKIPGKA
Download sequence
Identical sequences ENSGGOP00000027725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]