SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027737 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027737
Domain Number 1 Region: 6-172
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.99e-56
Family G proteins 0.0000000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027737   Gene: ENSGGOG00000000250   Transcript: ENSGGOT00000028122
Sequence length 195
Comment pep:known_by_projection chromosome:gorGor3.1:18:9845780:10002538:1 gene:ENSGGOG00000000250 transcript:ENSGGOT00000028122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIW
DTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNK
CDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGT
IKVEKPTMQASRRCC
Download sequence
Identical sequences G3SHZ7 H2RHY0
ENSGGOP00000027737 ENSP00000461945 NP_006859.2.87134 NP_006859.2.92137 XP_018869688.1.27298 XP_523865.3.37143 ENSPTRP00000041988 ENSGGOP00000000246 ENSP00000461945 gi|33589861|ref|NP_006859.2| ENSP00000304565 ENSPTRP00000061136 9606.ENSP00000304565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]