SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027746 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027746
Domain Number 1 Region: 4-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000214
Family EGF-type module 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027746   Gene: ENSGGOG00000026281   Transcript: ENSGGOT00000022878
Sequence length 43
Comment pep:novel chromosome:gorGor3.1:cutchr:6387210:6387338:1 gene:ENSGGOG00000026281 transcript:ENSGGOT00000022878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPA
Download sequence
Identical sequences Q19UK5
ENSGGOP00000027746 ENSGGOP00000027746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]