SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027757 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027757
Domain Number 1 Region: 48-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000002
Family EGF-type module 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027757   Gene: ENSGGOG00000005132   Transcript: ENSGGOT00000025629
Sequence length 166
Comment pep:known_by_projection chromosome:gorGor3.1:2a:71764793:71874175:-1 gene:ENSGGOG00000005132 transcript:ENSGGOT00000025629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRIGRGALDLLSELLSFGGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQF
CFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVL
IITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Download sequence
Identical sequences A0A2I2ZCX9 A0A2J8N4B8
ENSGGOP00000005028 ENSGGOP00000027757 XP_003830995.1.60992 XP_018877138.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]