SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027771 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027771
Domain Number 1 Region: 260-499
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.24e-70
Family Nuclear receptor ligand-binding domain 0.000000000647
Further Details:      
 
Domain Number 2 Region: 58-143
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.17e-32
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027771   Gene: ENSGGOG00000000541   Transcript: ENSGGOT00000033326
Sequence length 511
Comment pep:known_by_projection chromosome:gorGor3.1:15:39692981:39752147:-1 gene:ENSGGOG00000000541 transcript:ENSGGOT00000033326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYSQKEDKELQTGYMNAQIEIIP
CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQK
CLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANG
LTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASG
FFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQ
NKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAF
DSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSAD
RSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFK
AIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
Download sequence
Identical sequences ENSGGOP00000027771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]