SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027789 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027789
Domain Number 1 Region: 2209-2273
Classification Level Classification E-value
Superfamily Homeodomain-like 8.98e-19
Family Homeodomain 0.0045
Further Details:      
 
Domain Number 2 Region: 2576-2646
Classification Level Classification E-value
Superfamily Homeodomain-like 1.28e-18
Family Homeodomain 0.0052
Further Details:      
 
Domain Number 3 Region: 2901-2970
Classification Level Classification E-value
Superfamily Homeodomain-like 6.84e-18
Family Homeodomain 0.0041
Further Details:      
 
Domain Number 4 Region: 2114-2183
Classification Level Classification E-value
Superfamily Homeodomain-like 5.56e-16
Family Homeodomain 0.011
Further Details:      
 
Domain Number 5 Region: 2987-3031
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000701
Family HkH motif-containing C2H2 finger 0.0004
Further Details:      
 
Domain Number 6 Region: 1539-1613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000246
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 1397-1444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000594
Family Classic zinc finger, C2H2 0.062
Further Details:      
 
Domain Number 8 Region: 688-730
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000425
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 740-798
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000235
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 1947-1969,2291-2316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00003
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027789
Domain Number - Region: 2477-2499,2654-2679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000221
Family Classic zinc finger, C2H2 0.048
Further Details:      
 
Domain Number - Region: 1040-1085
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000789
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 3412-3461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000813
Family Classic zinc finger, C2H2 0.051
Further Details:      
 
Domain Number - Region: 1217-1241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00298
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number - Region: 928-973
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00982
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number - Region: 3147-3156
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0105
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 614-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0216
Family Classic zinc finger, C2H2 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027789   Gene: ENSGGOG00000024837   Transcript: ENSGGOT00000031036
Sequence length 3600
Comment pep:known_by_projection chromosome:gorGor3.1:8:75108505:75293082:1 gene:ENSGGOG00000024837 transcript:ENSGGOT00000031036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEA
LLGFSVENAAATQVTSAKEIPCNECATSFPSLQKYMEHHCPNARLPVLKDDNESEISELE
DSDVENLTGEIVYQPDGSAYIIEDSKESGQNAQAGANSKLFSTAMFLDSLASAGEKSDQS
ASAPMSFYPQIINTFHIASSLGKPFTADQAFPNTSALAGVGPVLHSFRVYDLRHKREKDY
LTSDGSAKNSCVSKDVPNNVDLSKFDGCISDGKRKPVLMCFLCKLSFGYIRSFVTHAVHD
HRMTLNDEEQKLLSNKCVSAIIQGIGKDKEPLISFLEPKKSTSVYPHFSTTNLIGPDPTF
RGLWSAFHVENGDSLPAGFAFLKGSASTSSSAEQPLGITQMPKAEVNLGGLSSLVVNTPI
TSVSLSHSLSESSKMSESKDQENNCERPKESNVLHPNGECPVKSEPTEPGDEDEEDAYSN
ELDDEEVLGELTDSIGNKDFPLLNQSISPLSSSVLKFIEKGTSSSSATVSDDTEKKKQTA
AVRASGSVANNYGISGKDFADASASKDSATAAHPSEIARGDEDSSATPHQHGFTPSTPGT
PGPGGDGSPGSGIECPKCDTVLGSSRSLGGHMTMMHSRNSCKTLKCPKCNWHYKYQQTLE
AHMKEKHPEPGGSCVYCKTGQPHPRLARGESYTCGYKPFRCEVCNYSTTTKGNLSIHMQS
DKHLNNVQNLQNGNGEQVFGHSAPAPNTSLSGCGTPSPSKPKQKPTWRCEVCDYETNVAR
NLRIHMTSEKHMHNMMLLQQNMKQIQHNLHLGLAPAEAELYQYYLAQNIGLTGMKLENPA
DPQLMINPFQLDPATAAALAPGLVNNELPPEIRLASGQLMGDDLSLLTAGELSPYISDPA
LKLFQCAVCNKFTSDSLEALSVHVSSERSLPEEEWRAVIGDIYQCKLCNYNTQLKANFQL
HCKTDKHMQKYQLVAHIKEGGKSNEWRLKCIAIGNPVHLKCNACDYYTNSVDKLRLHTTN
HRHEAALKLYKHLQKQEGAVNPESCYYYCAVCDYSTKVKLNLVQHVRSVKHQQTEGLRKL
QLHQQGLAPEEDNLSEIFFVKDCPPNELEAASLGARTCDDDLTEQQLRSTSEEQSEEAEG
AIKPTAVAEDDEKDTSERDNSEGKNSNKDSGIITPEKELKVSVAGGTQPLLLAKEEDVAT
KRSKPTEDNKFCHEQFYQCPYCNYNSRDQSRIQMHVLSQHSVQPVICCPLCQDVLSNKMH
LQLHLTHLHSVSPDCVEKLLMTVPVPDVMMPNSMLLPAAASEKSERDTPAAMTAEGSGKY
SGESPMDDKSIAGLEDSKANVEVKNEEQKPTKEPLEVSEWNKNSSKDVKIPDTMQDQLNE
QQKRQPLSVSDRHVYKYRCNHCSLAFKTMQKLQIHSQYHAIRAATMCNLCQRSFRTFQAL
KKHLEAGHPELSEAELQQLYASLPVNGELWAESETMAQDDHGLEQEMEREYEVDHEGKAS
PVGSDSSSIPDDMGSEPKRTLPFRKGPNFTMEKFLDPSRPYKCTVCKESFTQKNILLVHY
NSVSHLHKLKKVLQEASSPVPQETNSNTDNKPYKCSICNVAYSQSSTLEIHMRSVLHQTK
ARAAKLEPSGHVAGGHSIAANVNSPGQGMLDSMSLAAVNSKDTHLDAKELNKKQTPDLIS
AQPTHHPPQSPAQIQMQLQHELQQQAAFFQPQFLNPAFLPHFPMTPEALLQFQQPQFLFP
FYIPGTEFSLGPDLGLPGSATFGMPGMTGMAGSLLEDLKQQIQTQHHVGQTQLQILQQQA
QQYQATQPQLQPQKQQQQPPPPQQQQQQQASKLLKQEQSNIVSADCQIMKDVPSYKEAED
ISEKPEKPKQEFINESEGLKEGKDTKKQKSLEPSIPPPRIASGARGNAAKALLENFGFEL
VIQYNENRQKVQKKGKSGEGENTDKLECGTCGKLFSNVLILKSHQEHVHGQFFPYGALEK
FARQYREAYDKLYPISPSSPETPPPPPPPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPP
TPPPPSAPPQVQLPVSLDLPLFPSIMMQPVQHPALPPQLALQLPQMDALSADLTQLCQQQ
LGLDPNFLRHSQFKRPRTRITDDQLKILRAYFDINNSPSEEQIQEMAEKSGLSQKVIKHW
FRNTLFKERQRNKDSPYNFSNPPITVLEDIRIDPQPTSLEHYKSDASFSKRSSRTRFTDY
QLRVLQDFFDTNAYPKDDEIEQLSTVLNLPTRVIVVWFQNARQKARKSYENQAETKDNEK
RELTNERYIRTSNMQYQCKKCNVVFPRIFDLITHQKKQCYKDEDDDAQDESQTEDSMDAT
DQVVYKHCTVSGQTDAAKNAAAPAASSGSGTSTPLIPSPKPEPEKTSPKPEYPAEKPKQS
DPSPPSQGTKPALPLASTSSDPPQASTAQPQPQPQPPKQPQLIGRPPSASQTPVPSSPLQ
ISMTSLQNSLPPQLLQYQCDQCTVAFPTLELWQEHQHMHFLAAQNQFLHSPFLERPMDMP
YMIFDPNNPLMTGQLLGSSLTQMPPQASSSHTTAPTTVAASLKRKLDDKEDNNCSEKEGG
NSGEDQHRDKRLRTTITPEQLEILYEKYLLDSNPTRKMLDHIAREVGLKKRVVQVWFQNT
RARERKGQFRAVGPAQSHKRCPFCRALFKAKSALESHIRSRHWNEGKQAGYSLPPSPLIS
TEDGGESPQKYIYFDYPSLPLTKIDLSSENELASTVSTPVSKTAELSPKNLLSPSSFKAE
CSEDVENLNAPPAEAGYDQNKTDFDETSSINTAISDATTGDEGNTEMESTTGSSGDVKPA
LSPKEPKTLDTLPKPATTPTTEVCDDKFLFSLTSPSIHFNDKDGDHDQSFYITDDPDDNA
DRSETSSIADPSSPNPFGSSNPFKSKSNDRPGHKRFRTQMSNLQLKVLKACFSDYRTPTM
QECEMLGNEIGLPKRVVQVWFQNARAKEKKFKINIGKPFMINQGGTEGTKPECTLCGVKY
SARLSIRDHIFSKQHISKVRETVGSQLDREKDYLAPTTVRQLMAQQELDRIKKASDVLGL
TVQQPGMMDSSSLHGISLPAAYPGLPGLPPVLLPGMNGPSSLPGFPQNSNTLTPPGAGML
GFPTSATSSPALSLSSAPTKPLLQTPPPPPPPPPPPPSSSLSGQQTEQQNKESEKKQTKP
NKVKKIKEEELEATKPEKHPKKEEKISSALSVLGKVVGETHVDPTQLQALQNAIAGDPAS
FIGGQFLPYFIPGFASYFTPQLPGTVQGGYFPPVCGMESLFPYGPTMPQTLAGLSPGALL
HQYQQYQQNLQESLQKQQKQQQEQQQKPVQAKTSKVESDQPQNSNDASETKEDKSTATES
TKEEPQLESKSADFSDTYVVPFVKYEFICRKCQMMFTDEDAAVNHQKSFCYFGQPLIDPQ
ETVLRVPVSKYQCLACDVAISGNEALSQHLQSSLHKEKTIKQAMRNAKEHVRLLPHSVCS
PNPNTTSTSQSAASSNNTYPHLSCFSMKSWPNILFQASARRAASPPSSPPSLSLPSTVTS
SLCSTSGVQTSLPTESCSDESDSELSQKLEDLDNSLEVKAKTASGLDGNFNSIRMDMFSV
Download sequence
Identical sequences ENSGGOP00000022938 ENSGGOP00000027789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]