SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027791 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027791
Domain Number 1 Region: 37-210
Classification Level Classification E-value
Superfamily Lysozyme-like 1.31e-24
Family G-type lysozyme 0.00000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027791   Gene: ENSGGOG00000025984   Transcript: ENSGGOT00000025975
Sequence length 212
Comment pep:known_by_projection chromosome:gorGor3.1:2a:96638250:96653547:-1 gene:ENSGGOG00000025984 transcript:ENSGGOT00000025975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSMVFWGLIALIGTSRGSYPFTHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMN
CGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRG
LKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFK
SGIEAIATPSDIDNDFVNDIIARAKFYKRQSF
Download sequence
Identical sequences G3SI51
XP_004031537.1.27298 ENSGGOP00000027791 ENSGGOP00000027791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]