SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027805 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027805
Domain Number 1 Region: 37-215
Classification Level Classification E-value
Superfamily PR-1-like 2.22e-54
Family PR-1-like 0.00011
Further Details:      
 
Domain Number 2 Region: 284-382
Classification Level Classification E-value
Superfamily LCCL domain 1.83e-29
Family LCCL domain 0.0012
Further Details:      
 
Domain Number 3 Region: 386-491
Classification Level Classification E-value
Superfamily LCCL domain 7.06e-29
Family LCCL domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027805   Gene: ENSGGOG00000002690   Transcript: ENSGGOT00000034180
Sequence length 497
Comment pep:known_by_projection chromosome:gorGor3.1:16:75372097:75466290:1 gene:ENSGGOG00000002690 transcript:ENSGGOT00000034180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEIL
MLHNKLRGQVQPQASNMEYMTWDDELEKSAAAWASQCIWEHGPTSLLVSIGQNLGAHWGR
YRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTC
RKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLCYREETY
TPKPETDEMNEVETAPIPEENHVWLQPRVMRPTKPKKTSVVNYMTQVVRCDTKMKDRCKG
STCNRYQCPAGCLNHKAKIFGTLFYESSSSICRAAIHYGILDDKGGLVDITRNGKVPFFV
KSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDE
PSYWAPVFGTNIYADTSSICKAAVHAGVISNESGGDVDVMPVDKKKTYVGSLRNGVQSES
LGTPRDGKAFRIFAVRQ
Download sequence
Identical sequences G3SI65
ENSGGOP00000027805 XP_004058128.1.27298 ENSGGOP00000002654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]