SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027806 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027806
Domain Number 1 Region: 823-851
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000328
Family A20-like zinc finger 0.018
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027806
Domain Number - Region: 22-59
Classification Level Classification E-value
Superfamily UBA-like 0.000255
Family TAP-C domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027806   Gene: ENSGGOG00000024965   Transcript: ENSGGOT00000030730
Sequence length 861
Comment pep:known_by_projection chromosome:gorGor3.1:1:128781554:128818673:-1 gene:ENSGGOG00000024965 transcript:ENSGGOT00000030730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILIYVLPTSSWLKVLDDHMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDVNAALSDFE
QLRQVHAGNLPPSFSEGSGGSRTPEKGFSDREPTRPPRPILQRQDDIVQEKRLSRGISHA
SSSIVSLARSHVSSNGGGGGSSEHPLEMPICAFQLPDLTVYNEDFRSFIERDLIEQSMLV
ALEQAGRLNWWVSVDPTSQRLLPLATTGDGNCLLHAASLGMWGFHDRDLMLRKALYALME
KGVEKEALKRRWRWQQTQQNKESGLVYTEDEWQKEWNELIKLASSEPRMHLGTNGANCGG
VESSEEPVYESLEEFHVFVLAHVLRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPA
SQCHRSPLVLAYDQAHFSALVSMEQKENTKEQAVIPLTDSEYKLLPLHFAVDPGKGWEWG
KDDSDNVRLASVILSLEVKLHLLHSYMNVKWIPLSSDAQAPLAQPESPTASAGDEPRSTP
ESGDSDKESVGSSSTSNEGGRRKEKSKRDREKDKKRADSVANKLGSFGKTLGSKLKKNMG
GLMHSKGSKPGGVGTGSGGSSGTETLEKKKKNSLKSWKGGKEEAAGDGPVSEKPPAESVG
NGGSKYSQEVMQSLSILRTAMQGEGKFIFVGTLKMGHRHQYQEEMIQRYLSDAEERFLAE
QKQKEAERKIMNGGIGGGPPPAKKPEPDAREEQPTGPPAESRAMAFSTGYPGDFTIPRPS
GGGVHCQEPRRQLAGGPCVGGLPPYATFPRQCPPGRPYPHQDSIPSLEPGSHSKDGLHRG
ALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYGHPETNNFCSCC
YREELRRREREPDGELLVHRF
Download sequence
Identical sequences ENSGGOP00000027806 ENSGGOP00000027806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]