SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027814 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027814
Domain Number 1 Region: 30-302
Classification Level Classification E-value
Superfamily L domain-like 1.7e-60
Family Ngr ectodomain-like 0.00000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027814   Gene: ENSGGOG00000009525   Transcript: ENSGGOT00000029441
Sequence length 405
Comment pep:known_by_projection chromosome:gorGor3.1:11:54177716:54193830:1 gene:ENSGGOG00000009525 transcript:ENSGGOT00000029441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPP
STQRLFLQNNLIRTLRPGTFGSNLLTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLR
SLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLAN
LSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFRGLSRLTILYLFNNSLA
SLPGEALADLPSLEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLR
ALREADFQAYSSSNHLYGVAEAGAPPADPSTLYRDLPAEDSRGRQGGDAPTEDDYWGGYG
GEDQRGEQTCPGAACQAPPDSRGPALSAGLPSPLLCLLLLVPHHL
Download sequence
Identical sequences ENSGGOP00000027814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]