SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027817 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027817
Domain Number 1 Region: 39-563
Classification Level Classification E-value
Superfamily SNF-like 1.19e-185
Family SNF-like 0.000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027817   Gene: ENSGGOG00000000379   Transcript: ENSGGOT00000024655
Sequence length 621
Comment pep:known_by_projection chromosome:gorGor3.1:3:11145300:11251542:1 gene:ENSGGOG00000000379 transcript:ENSGGOT00000024655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEKALPLGNGKAAEEARESEAPGGGCSDKRDKAVHERGHWNNKVEFVLSVAGEIIGLG
NVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGITCWRKVCPLFEG
IGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTENCVEFQKLNVSNY
SHVSLQNATSPVMEFWEHRVLAISDGIEHIGNLRWELALCLLAAWTICYFCIWKGTKSTG
KVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYLYPDLSRLSDPQVWVDAGTQIFFSYA
ICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMAYEQGVPIAEVA
ESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVTAVVDMYPKVFR
RGYRRELLILALSVISYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVAIFECICIGWVY
GSNRFYDNIEDMIGYRPPSLIKWCWKIMTPGICAGIFIFFLIKYKPLKYNNIYTYPAWGY
GIGWLMALSSMLCIPLWICITVWKTEGTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVND
CDAKLKSDGTIAAITEKETHF
Download sequence
Identical sequences ENSGGOP00000027817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]