SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027818 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027818
Domain Number 1 Region: 290-574
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-82
Family Protein kinases, catalytic subunit 0.000000000128
Further Details:      
 
Domain Number 2 Region: 789-927
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.26e-59
Family FAT domain of focal adhesion kinase 0.000000167
Further Details:      
 
Domain Number 3 Region: 13-134
Classification Level Classification E-value
Superfamily Second domain of FERM 1.07e-39
Family Second domain of FERM 0.000000406
Further Details:      
 
Domain Number 4 Region: 135-243
Classification Level Classification E-value
Superfamily PH domain-like 4.06e-37
Family Third domain of FERM 0.00000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027818   Gene: ENSGGOG00000011147   Transcript: ENSGGOT00000032748
Sequence length 933
Comment pep:known_by_projection chromosome:gorGor3.1:8:140790838:140998931:-1 gene:ENSGGOG00000011147 transcript:ENSGGOT00000032748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRS
YWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREES
ILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQV
QTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGASQSFI
IRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQR
ERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFD
HPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLES
KRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRF
TSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCW
AYDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPG
YPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQ
EIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRL
SRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYN
EGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGL
ALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQ
MLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
Download sequence
Identical sequences ENSGGOP00000027818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]