SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027819 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027819
Domain Number 1 Region: 63-208
Classification Level Classification E-value
Superfamily EF-hand 2.12e-40
Family Calmodulin-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027819   Gene: ENSGGOG00000010165   Transcript: ENSGGOT00000033747
Sequence length 210
Comment pep:known_by_projection chromosome:gorGor3.1:11:64429476:64434004:-1 gene:ENSGGOG00000010165 transcript:ENSGGOT00000033747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNCAKRPWRQGPKDPLQWLGSPPRGSQGDPGPGIQGYSVLNSLVGPACIFLRPSIAATQ
LDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELIEISQQISGGK
VDFEDFVELMGPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAALKALLGERLS
QREVDEILQDVDLNGDGLVDFEEFVRMMSR
Download sequence
Identical sequences ENSGGOP00000027819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]