SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027821 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027821
Domain Number 1 Region: 32-322
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.37e-66
Family Amylase, catalytic domain 0.000000000219
Further Details:      
 
Domain Number 2 Region: 323-417
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 9.71e-28
Family alpha-Amylases, C-terminal beta-sheet domain 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027821   Gene: ENSGGOG00000008092   Transcript: ENSGGOT00000024447
Sequence length 428
Comment pep:known_by_projection chromosome:gorGor3.1:X:98691929:98703779:-1 gene:ENSGGOG00000008092 transcript:ENSGGOT00000024447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEP
DSCISPVLFYKIISPMVSDGWKDLFLNFGGLCIPSAEVNLSFPSKGNFQDPIRKISMTAS
FLVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENLA
DGYKYMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIKS
ILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDLR
HISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIGG
PRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENTM
QMSLKDLL
Download sequence
Identical sequences ENSGGOP00000007907 ENSGGOP00000027821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]