SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027844 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027844
Domain Number 1 Region: 150-267
Classification Level Classification E-value
Superfamily C-type lectin-like 3.53e-37
Family Link domain 0.0015
Further Details:      
 
Domain Number 2 Region: 263-362
Classification Level Classification E-value
Superfamily C-type lectin-like 4.56e-29
Family Link domain 0.003
Further Details:      
 
Domain Number 3 Region: 1044-1141
Classification Level Classification E-value
Superfamily C-type lectin-like 9.65e-19
Family C-type lectin domain 0.00083
Further Details:      
 
Domain Number 4 Region: 44-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000255
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 
Domain Number 5 Region: 1009-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000002
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027844   Gene: ENSGGOG00000002977   Transcript: ENSGGOT00000031422
Sequence length 1155
Comment pep:known_by_projection chromosome:gorGor3.1:19:19598936:19620843:1 gene:ENSGGOG00000002977 transcript:ENSGGOT00000031422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGATFVWALGLLMLQMLLFVAGEQGTQDIADASERGLHMQKLGSGSVRAALAELVALPCL
FTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRHR
ANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRSARDRYALTFAEAQE
ACRLSSAIIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSY
GRRNPQEHYDVYCFARELGGEVFYVGPARRLTLAGARAQCRRQGAALASVGQLHLAWHEG
LDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPSPAERFDAYCFRAHH
PTSQHGDLETPSSGDEGEILSAEGPPVRELEPTLEEEEGVTPDFQEPLVSSGEEEPLILE
EKQESQQTLSPTPGDPMLASWPTGEVWLSTVAPSPSDMGAGTAASSHTEVAPTDPTPRRR
GRFKGLNGRYFQQQEPEPGLQGGMEASAQPPTSEAAGNQMEPPLAMAVTEMLGSGQSRSP
WADLTNEVDMPGAGSAGGKNSPEPWLWPPTMVPSSISGHSRAPVLELEKAEGPSARPATP
DLFWSPLEATVSAPSPAPWEAFPVATSPDLPMMAMLRGPKEWMLPHPTPISTEANRVEAH
GEATATAPPSPAAETKVYSLPLSSTPTGQGGEAMPTTPESPRADFRETGKTSPAQVNKAE
HSSSSPWPSVNRNVAVGFVPTETATAPTGLRDISGSESGVFDTAESPTSGLQATVDEVQD
PWPSVYSKGLDARSPSALLGSPGVFLVPKVTPSLEPWVATDEGPTVNPMDSTVTPAPSDA
SGIWEPGSQVFEEAQSTTLSPQVALDTSTVTPLTTLEQGDKVGVPAMSTLGSSSSQPDPE
PEDQVETQGTSGASVPPHQSSPLGKPAVPPGTPTAASVGESASVSSGEPTVPWDPSSTLL
PVTLGIEDFELEVLAGSPGVESSWEEVASGEEPALPGTPMNAGAEEVHSDPCENNPCLHG
GTCNANGTMYGCSCDQGFAGENCEIDIDDCLCSPCENGGTCIDEVNGFVCLCLPSYGGSF
CEKDTEGCDRGWHKFQGHCYRYFAHRRAWEDAERDCRRRSGHLTSVHSPEEHSFINSRGS
GEGATCLEGGQGWHL
Download sequence
Identical sequences ENSGGOP00000027844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]