SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027849 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027849
Domain Number 1 Region: 481-654
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.07e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0033
Further Details:      
 
Domain Number 2 Region: 636-733
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.96e-18
Family Ypt/Rab-GAP domain of gyp1p 0.026
Further Details:      
 
Domain Number 3 Region: 801-937
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000115
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027849   Gene: ENSGGOG00000003028   Transcript: ENSGGOT00000026646
Sequence length 1250
Comment pep:known_by_projection chromosome:gorGor3.1:5:164422056:164467892:-1 gene:ENSGGOG00000003028 transcript:ENSGGOT00000026646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLSPEEVLVANALWVTERANPFFVLQRRRGHGKGGGLTGLLVGTLDVVLDSSARVAPYR
ILHQTQDSQVYWTVACGSSRKEITKHWEWLENNLLQTLSIFDSEEDITTFVKGKIHGIIA
EENKNLQPQGDEDPGKFKEAELKMRKQFGMPEGEKLVNYYSCSYWKGRVPRQGWLYLTVN
HLCFYSFLLGKEVSLVVQWVDITRLEKNATLLFPESIRVDTRDQELFFSMFLNIGETFKL
MEQLANLAMRQLLDSEGFLEDKALPRPIRPHRNISALKRDLDARAKNECYRATFRLPRDE
RLDGHTSCTLWTPFNKLHIAGQMFISNNYICFASKEEDACHLIIPLREVTIVEKADSSSV
LPSPLSISTKSKMTFLFANLKDRDFLVQRISDFLQKTPSKQPGSIGSRKASAVDPSTESS
PAPQEVSEQPASPASPLSSRQSFCVQEVPTASQGLLKLFQKNSPMEDLGAKGAKEKMKEE
SWHIHFFEYGRGVCMYRTAKTRALVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELVE
KSTGKYSLATEEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIVT
SVLLLYGSEEEAFWLLVALCERMLPDYYNTRVVGALVDQGIFEELTRDFLPQLSEKMQDL
GVISSISLSWFLTLFLSVMPFESAVVIVDCFFYEGIKVILQVALAVLDANMEQLLGCSDE
GEAMTMLGRYLDNVVNKQSVSPPIPHLRALLSSGDDPPAEVDIFELLKVSYEKFSSLRAE
DIEQMRFKQRLKVIQSLEDTAKRSVVRAIPVDIGFSIEELEDLYMVFKAKHLASQYWGCS
RTMAGRRDPSLPYLEQYRIDASQFRELFASLTPWACGSHTPLLAGRMFRLLDENKDSLIN
FKEFVTGMSGMYHGDLTEKLKVLYKLHLPPALSPEEAESALEAAHYFTEDSSSEASPLAS
DLDLFLPWEAQEALPQEEQEGSGSEERGEEKGTSSPDYRHYLRMWAKEKEAQKETIKDLP
KMNQEQFIELCKTLYNMFSEDPMEQDLYHAIATVASLLLRIGEVGKKFSARTGRKPRDCA
TEEDEPPAPELHQDAARELQPPAAGDPQAKAGGDTHLGKAPQESQVVVEGGSGEGRGSPS
QLLSDDETKDDMSMSSYSVVSTGSLQCEDLADDTVLVGGEAGSPTARIGGTVDTDWCISF
EQILASILTESVLVNFFEKRVDIGLKIKDQKKVERQFSTASDHEQPGVSG
Download sequence
Identical sequences G3SIA9
XP_004043189.1.27298 ENSGGOP00000027849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]