SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027856 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027856
Domain Number 1 Region: 21-123
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000475
Family SPRY domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027856   Gene: ENSGGOG00000005611   Transcript: ENSGGOT00000027086
Sequence length 200
Comment pep:known_by_projection chromosome:gorGor3.1:13:32156606:32172081:-1 gene:ENSGGOG00000005611 transcript:ENSGGOT00000027086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPL
HQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGRDVHSLVMRNDGALYHNNEEKNRLPA
NSLPQEGDVVVKCSHSHLFLNLYKFHSNMHLSGSPIMRVTYFLFYYPLVDDSAILDCQFS
EFYHTPPPGFEKILFEQQIF
Download sequence
Identical sequences ENSGGOP00000005492 ENSGGOP00000027856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]