SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027863 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027863
Domain Number 1 Region: 84-330
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.64e-39
Family Nuclear receptor ligand-binding domain 0.00024
Further Details:      
 
Domain Number 2 Region: 13-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.64e-29
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027863   Gene: ENSGGOG00000010051   Transcript: ENSGGOT00000031125
Sequence length 331
Comment pep:novel chromosome:gorGor3.1:6:108152735:108222809:-1 gene:ENSGGOG00000010051 transcript:ENSGGOT00000031125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGC
PVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHF
PSAALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEV
ATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDAN
TLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTH
SGSELRSFRNAAAIAALQDEAQLTLNSYIHT
Download sequence
Identical sequences ENSGGOP00000027863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]