SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027873 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027873
Domain Number 1 Region: 350-476
Classification Level Classification E-value
Superfamily SH2 domain 8.21e-26
Family SH2 domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027873   Gene: ENSGGOG00000015778   Transcript: ENSGGOT00000024480
Sequence length 479
Comment pep:known_by_projection chromosome:gorGor3.1:1:133481386:133499298:-1 gene:ENSGGOG00000015778 transcript:ENSGGOT00000024480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWSPTPGASACLGWASSLACSTAPTLLGRAGRGPLMAAKWFKEFPLNLKTVSERAKPGG
GGGKLRKNSEAGGAGPGPGKGRKNSAAELGSGRAGVGPKDSRLSRDSLQGLIQAAAGKGR
KNSRATEEEPHRGATKSSGCSTYINRLIKVDTQEKNGKSSYPSSSLGPELDKGKIIKQQD
TVIILEDYADPYDAKRTKGQRDAERVGENDGYMEPYDAQQMITEIRRRGSKDPLVKALQL
LDSPCEPADGGLKSETLAKRRSSKDLLGKPPQLYDTPYEPAEGGPRAEGKARPPDSRLPE
NDERPAAEYEQPWEWKKEQIVRALSVQFEGAERPSVREETVRQHHRQKSWTQKILKPALS
DHSEGEKVDPGLPLEKQPWYHGAISRAEAESRLQPCKEAGYLVRNSESGNSRYSIALKTS
QGCVHIIVAQTKDNKYTLNQTSAVFDSIPEVVHYYSNEKLPFKGAEHMTLLYPVHSKLH
Download sequence
Identical sequences ENSGGOP00000027873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]