SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027880 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027880
Domain Number 1 Region: 245-358,415-466,589-757
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.39e-36
Family WD40-repeat 0.0049
Further Details:      
 
Domain Number 2 Region: 680-908
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.01e-17
Family WD40-repeat 0.02
Further Details:      
 
Domain Number 3 Region: 966-1085
Classification Level Classification E-value
Superfamily EF-hand 0.0000000329
Family Calmodulin-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027880   Gene: ENSGGOG00000008518   Transcript: ENSGGOT00000031541
Sequence length 1135
Comment pep:known_by_projection chromosome:gorGor3.1:12:121808132:121895503:1 gene:ENSGGOG00000008518 transcript:ENSGGOT00000031541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDAEEAPREATGENGETEMKEEEEPNPNYKEVEDPQQESKDDTLAWRESKKIVMEETEE
KAGEVQEKEASGIQEETTVEPQEVTESMIHLETQITDSQSITSGIFPKTQRGSKSKLSLQ
LEDAETDELLRDLSTQIEFLDLDQISPEEQQISSPERQPSGELEEKTDRMPQDELGQERR
DLEPENREEGQERRVSDIQSKAGISRESLVSSTTEDILFQKDKSAPVYPLTMTWSFGWNS
SLPVYYIREERQRVLLYVCAHTAIIYNVFRNNQYHLQGHANIISCLCVSEDRRWITTADK
GPDCLVIIWDSFTGIPVHTIFDSCPEGNGIRAMAMTHDAKYLATISDAEVQKVCIWKWTL
AVDTPACTLELPTEYGVQGIVIYSQGHSKILCGPVKFRNVYAAVFINESTKKLTITFLLK
QTFNKLVGKFSQSIFHLNLTQILSATMEGKLVVWDIHRPPSSASTFLGFPYIKPCKLVHL
QKEGITVLTTIDSYGILGRIIMNWEHWLPLRKRTLHSRLGEIMSKSFLKSPFGMDPRTGN
NPFCPPSLECSTLILFGLSLANRNFIIGTSDAAVYHLTTDGTKLEKLFVEPKDAICAISC
HPYQPLIAIGSICGMIKVWNYENKQYLFSRVFEKGLGVQSLTYNPEGALLGAGFTEGTVY
ILDAMSLENESPEPFKYSRTSVTHISFSHDSQYMATADRSFTVAVYMLVVRNGQRVWEYL
ARLRSHRKSIRSLLFGVYLDSNEPRLLSLGTDRLLIEYDLLRSYKDHLEVLDIHHTDQGC
YPTCMVWYPPLTRELFLLICNSGYKVKLFNATTKMCRKTLLGPAYGSPIEQTQVLPVRSM
AELQKRYLVFINRDKVGLQILPVDGNPHKTSAIVCHPNGVAGMAVSYDGRYAFTAGGHDR
SVVQWKITLSVLEAAVSLGGEDLTPFYGLLSGGREGKFYRELEDYFYYSQLRSQGIDTME
TRKVSEHICLSELPFVMRAIGFYPSEEKIDDIFNEIKFGEYVDTGKLIDKINLPDFLKVY
LNHKPPFGNTMSGIHKSFEVLGYTNSKGKKAIRREDFLRLLVTKGEHMTEEEMLDCFASL
FGLNPEGWKSEPATASVKGSEICLEEELPDEITAEIFATEILGLTISEDSGQDGQ
Download sequence
Identical sequences ENSGGOP00000008333 ENSGGOP00000027880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]