SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027884 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027884
Domain Number 1 Region: 249-415,807-983
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.01e-123
Family Mammalian PLC 0.00000678
Further Details:      
 
Domain Number 2 Region: 465-578
Classification Level Classification E-value
Superfamily SH2 domain 9.83e-26
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 3 Region: 1000-1121
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.89e-24
Family PLC-like (P variant) 0.0031
Further Details:      
 
Domain Number 4 Region: 559-674
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-22
Family SH2 domain 0.0000602
Further Details:      
 
Domain Number 5 Region: 704-767
Classification Level Classification E-value
Superfamily SH3-domain 9.98e-19
Family SH3-domain 0.00022
Further Details:      
 
Domain Number 6 Region: 3-67
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000263
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 
Domain Number 7 Region: 97-246
Classification Level Classification E-value
Superfamily EF-hand 0.00000000304
Family Calbindin D9K 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027884   Gene: ENSGGOG00000017132   Transcript: ENSGGOT00000032651
Sequence length 1203
Comment pep:known_by_projection chromosome:gorGor3.1:16:72349675:72455153:1 gene:ENSGGOG00000017132 transcript:ENSGGOT00000032651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAVNWL
SGLKILHQEAMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSAKFL
KDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASAVYL
HDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENSIWD
EKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDCWDG
PDGKPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMAKAFKE
VFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELYM
WDSIDQKWTRHYCAIADAKLSFSDDIEQTVEEEVPQDIPATELHFGEKWFHKKVEKRTSA
EKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYYLTD
NLTFSSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDMLMRI
PRGGYFLSKKKIGKNTHIIVFSRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYYEK
HSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDYKA
KRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADFEELEKQIIED
NPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKKQGDPPVEFATDRVEELFEWFQS
IREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVETK
ADSIIRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKYMQ
MNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSIAC
PFVEVEICGAEYDNNKFKTTVVNDNGLSPIWAPTQEKVTFEIYDPNLAFLRFVVYEEDMF
SDPNFLAHATYPIKAIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSCRQ
LRRRQEELNNQLFLYDTHQNLRNANRDALVKEFSVNENQLQLYQEKCNKRLREKRVSNSK
FYS
Download sequence
Identical sequences ENSGGOP00000027884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]