SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027902 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000027902
Domain Number - Region: 30-84
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0314
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027902   Gene: ENSGGOG00000027335   Transcript: ENSGGOT00000024416
Sequence length 172
Comment pep:known_by_projection chromosome:gorGor3.1:10:111085762:111086649:1 gene:ENSGGOG00000027335 transcript:ENSGGOT00000024416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSPPAPRKSPEARGGRYGRRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHFA
LFVSVLFWLLTLGLYFLTLLGKHELVPVLGSRWLMVNVAHDVLAAALYGAATGIMSDQMQ
RHSYCNLKDYPLPCAYHAFLAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA
Download sequence
Identical sequences ENSGGOP00000027902 ENSGGOP00000027902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]