SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027913 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000027913
Domain Number - Region: 640-730
Classification Level Classification E-value
Superfamily STAT 0.0116
Family STAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027913   Gene: ENSGGOG00000026365   Transcript: ENSGGOT00000027240
Sequence length 863
Comment pep:known_by_projection chromosome:gorGor3.1:1:64238290:64243095:1 gene:ENSGGOG00000026365 transcript:ENSGGOT00000027240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVSTSVQSKFARLAKKKENITYMKREQLTETDKDIAPVLDLKCKDVSAIMNKFKVLME
IQDLMFEEMRETLKNDLKAVLGGKATIPEVKNSENSSSRTEFQQIINLALQKTGMVGKIE
GENSKIGDDNENLTFKLKEVNELSGKLDNTNKYNSNDGKKLLQDESRSYEVMGSMEETLC
NIDDRDGNRNVHLEFTERESRKDGEDEFVKEMREERKFEKFKNKEDVLKASREEKVLMDE
GAVLTLAADLSSATLDISKQWSNVFNILREHDFEPKFLCEVKLAFKCDGEIKTFSDLQSL
RKFASQKSSMKELLKDVLPQKEEINQGGRKYGIQEKRGKTLIDSKHRAGEITSDGLSFLF
LKEVKVAKPEEMNNLETQEEELEELDEEASGMEDDEDTSGLEEEEEEASGLEEEEEEEAS
GLEEDEASGLEEEEEQTSEQDSTFQGHTLVDAKHEVEITSDGMETTFIDSVEDSESEEEE
EGKSSEIGKVKTTSLTEKKASRRQKKIPFSYLVGDSGKKKLVKHQVVHKTQEEEETAVPT
SQGTGTPCLTLCLASPSKSLEMGHDEHKKHSHTNLSISTGVTKLKKTEEKKHRTLHTEEL
TSKEADLTEETEENLRSSVINSIRDIKEEIGNLKSSHSGVLEIENSVDDLSSRMDILEER
IDSLEDQIEEFSKDTVQMTKQIISKERQRDIEERSRSCNIRLIGIPEKENYENRAEDIIK
EIIDENFAELKKGSSLEIVSACRVPSKIDEKRLTPRHILVKFWNSSDKEKIIRASRERRE
ITYQGTRIRLTADLSLDTLDARSKWSNVFKVLLEKGFNPRILYPAKMAFDFRGNTKVFLS
IEEFRDYVLHMPTLRELLGNNIP
Download sequence
Identical sequences ENSGGOP00000027913 ENSGGOP00000027913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]