SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027953 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027953
Domain Number 1 Region: 485-609
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.2e-49
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000271
Further Details:      
 
Domain Number 2 Region: 127-347
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.34e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000367
Further Details:      
 
Domain Number 3 Region: 301-436
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000544
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000742
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027953   Gene: ENSGGOG00000007635   Transcript: ENSGGOT00000026730
Sequence length 614
Comment pep:known_by_projection chromosome:gorGor3.1:X:127592129:127638700:-1 gene:ENSGGOG00000007635 transcript:ENSGGOT00000026730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGAS
GGKIDKSVLVLIVGLSTVGAGAYAYKTIKEDEKRYNERISGLGLTPEQKEKKATLSASEG
EEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELW
FSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHTENGGVAVLTGKKVVQLDVRD
NMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREV
KSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREG
VKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG
FRVNAELQARSNIWVVILFLAVFYNLLWSQGRTYRRDMAAAKPAIEGQTSTGTACLWSQK
SDPRSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEAS
EITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHE
DLNEVAKLFNIHED
Download sequence
Identical sequences ENSGGOP00000027953 ENSGGOP00000007470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]