SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027967 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027967
Domain Number 1 Region: 425-598,626-694
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.16e-16
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 2 Region: 72-310
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000228
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027967   Gene: ENSGGOG00000010594   Transcript: ENSGGOT00000029236
Sequence length 746
Comment pep:known_by_projection chromosome:gorGor3.1:11:65991166:66066179:1 gene:ENSGGOG00000010594 transcript:ENSGGOT00000029236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLLGGSLGEGGRFWTEMSLCQSPDVSPLPAGAAARWDLCIDQAVVFIEDAIQYRSINHRV
DASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEPPCGLTE
SVEVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVCHEPLRI
RRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAGGKQDDG
QDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGSLFLMNL
LTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQNLLQVL
RKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPGYQSPFLQSAQ
FLFGHYYFDYLGNLIALANLVTICVFLVLDADVLPAERDDFILGILNCVFIVYYLLEMLL
KVFALGLRGYLSYPSNVFDGLLTIVLLVLEISTLAVYRLPHPGWRPEMLGLLSLWDMTRM
LNMLIVFRFLRIIPSMKPMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIV
APPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVNNWQVFLDAYRRYS
GPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPRSHLQPLAGTPEATYQMTVELLF
RDILEEPGEDELTERLSQHPHLWLCR
Download sequence
Identical sequences ENSGGOP00000027967 ENSGGOP00000010343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]