SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027976 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027976
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.24e-65
Family N-terminal domain of xrcc1 0.0000000837
Further Details:      
 
Domain Number 2 Region: 543-633
Classification Level Classification E-value
Superfamily BRCT domain 1.96e-22
Family DNA-repair protein XRCC1 0.00000643
Further Details:      
 
Domain Number 3 Region: 323-407
Classification Level Classification E-value
Superfamily BRCT domain 8.37e-22
Family BRCT domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027976   Gene: ENSGGOG00000002526   Transcript: ENSGGOT00000030507
Sequence length 637
Comment pep:known_by_projection chromosome:gorGor3.1:19:40746172:40780722:-1 gene:ENSGGOG00000002526 transcript:ENSGGOT00000030507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI
GNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAA
AEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDE
STNSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSISKPQE
SPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKCELTRSLVSRPPVVLTESTLCQGAVT
GKPRGEGTEPRRPRAGPEDLGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTRD
STHLICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSRRYLMAGPGSSSEEDEAS
HSGGSGDEAPKLPQKRPQTKTKPIQAAGPSSPQKPPTPEETKAASPVLQEDIDIEGVQSE
GQDNGAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPV
PELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEE
ALMDNPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA
Download sequence
Identical sequences ENSGGOP00000002490 ENSGGOP00000027976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]