SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027983 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027983
Domain Number 1 Region: 48-113
Classification Level Classification E-value
Superfamily SNARE fusion complex 3.61e-23
Family SNARE fusion complex 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027983   Gene: ENSGGOG00000023200   Transcript: ENSGGOT00000025530
Sequence length 141
Comment pep:known_by_projection chromosome:gorGor3.1:1:150925242:150968080:-1 gene:ENSGGOG00000023200 transcript:ENSGGOT00000025530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQV
DEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIM
ALVAAILLLVIIILIVMKYRT
Download sequence
Identical sequences A0A096N8H6 A0A2J8UBR2 A0A2K5MH35 A0A2K5YQH7 A0A2K6B2F0 A0A2K6KV17 A0A2K6Q965 G1RYX7 G3SIP3 G7MFC1 G7NVH0 H2Q0L8 O75379 Q6IAZ3
ENSPANP00000008907 ENSP00000236192 ENSP00000236192 ENSP00000435933 ENSNLEP00000018454 NP_003753.2.87134 NP_003753.2.92137 XP_003258923.1.23891 XP_003824705.1.60992 XP_008976550.1.60992 XP_009436528.1.37143 XP_009436532.1.37143 XP_010369594.1.97406 XP_010369595.1.97406 XP_011744263.1.29376 XP_011744264.1.29376 XP_011744265.1.29376 XP_011855832.1.47321 XP_011941275.1.92194 XP_011941277.1.92194 XP_014979620.1.72884 XP_014979624.1.72884 XP_014979630.1.72884 XP_015300963.1.63531 XP_016788038.1.37143 XP_017722384.1.44346 XP_017722385.1.44346 XP_017722386.1.44346 XP_018882184.1.27298 XP_018882192.1.27298 gi|42544207|ref|NP_003753.2| ENSP00000236192 ENSP00000435933 9598.ENSPTRP00000002799 9606.ENSP00000236192 ENSGGOP00000027983 ENSNLEP00000018454 ENSPTRP00000002799 ENSPTRP00000002799 ENSGGOP00000027983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]