SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027984 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027984
Domain Number 1 Region: 185-327
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-40
Family Third domain of FERM 0.00041
Further Details:      
 
Domain Number 2 Region: 85-187
Classification Level Classification E-value
Superfamily Second domain of FERM 4.84e-27
Family Second domain of FERM 0.00014
Further Details:      
 
Domain Number 3 Region: 3-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.31e-21
Family First domain of FERM 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027984
Domain Number - Region: 485-510
Classification Level Classification E-value
Superfamily Probable GTPase Der, C-terminal domain 0.0798
Family Probable GTPase Der, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027984   Gene: ENSGGOG00000008350   Transcript: ENSGGOT00000028697
Sequence length 714
Comment pep:known_by_projection chromosome:gorGor3.1:X:129584161:129635219:-1 gene:ENSGGOG00000008350 transcript:ENSGGOT00000028697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLKVQFLDDSQKIFVADQKSSGKALFNLSCSHLNLAEKEYFGLEFCSHSGNNVWLELL
KPITKQVKNPKEIVFKFMVKFFPVDPGHLREELTRYLFTLQIKKDLALGRLPCSDNCTAL
MVSHILQSELGDFHEETDRKHLAQTRYLPNQDCLEGKIMHFHQKHIGRSPAESDILLLDI
ARKLDMYGIRPHPASDGEGMQIHLAVAHMGVLVLRGNTKINTFNWAKIRKLSFKRKHFLI
KLHANILVLCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSFR
YSGRTQRQLLEYGRKGRLKSLPFERKHYPSQYHERQCRSSPDLLSDVSKQVEDLRLAYGG
GYYQNVNGVHASEPVLESRRRNSALEVTFATELEHSKPEADPTLLHQSQSSSSFPFIYMD
PVFNTEPDPNPDPRDIFSERSSLSSFQTSCKFSGNHMSISSGLTSKVRPAKQLTYTDVPY
IPCTGQQVGIMPPQVFFYVDKPPQVPRWSPIRAEERTSPDSYVEPTAMKPAKRSPRNIRM
KSFQQDLQGLQEAIARTSGRSNINVGLEEEDPNLEDAFVYNIQEQTPKRSQSQSDMKTIR
FPFGSEFRPLGPCPALSHKADLFTDMFAEQELPAVLMDQSTAERYVASESSDSESEILKP
DYYALYGKEIRSPMARIRLSSGSLQLDEEDEDAYFNTPTAEDRTSLKPCNYFLA
Download sequence
Identical sequences G3SIP4
ENSGGOP00000008160 XP_004064921.1.27298 ENSGGOP00000027984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]