SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027991 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027991
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily Chaperone J-domain 9.29e-30
Family Chaperone J-domain 0.0000293
Further Details:      
 
Domain Number 2 Region: 247-331
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.02e-23
Family HSP40/DnaJ peptide-binding domain 0.00026
Further Details:      
 
Domain Number 3 Region: 163-244
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.75e-16
Family HSP40/DnaJ peptide-binding domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027991   Gene: ENSGGOG00000024610   Transcript: ENSGGOT00000023633
Sequence length 340
Comment pep:novel chromosome:gorGor3.1:19:14788412:14791996:-1 gene:ENSGGOG00000024610 transcript:ENSGGOT00000023633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK
REIFGXFCFSGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRN
GEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCT
KKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLK
DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGE
GLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
Download sequence
Identical sequences ENSGGOP00000027991 ENSGGOP00000017482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]