SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028006 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028006
Domain Number 1 Region: 173-326
Classification Level Classification E-value
Superfamily EF-hand 1.13e-24
Family Calmodulin-like 0.07
Further Details:      
 
Domain Number 2 Region: 60-195
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000895
Family Calbindin D9K 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028006   Gene: ENSGGOG00000026283   Transcript: ENSGGOT00000032958
Sequence length 335
Comment pep:known_by_projection chromosome:gorGor3.1:15:56596705:56615209:1 gene:ENSGGOG00000026283 transcript:ENSGGOT00000032958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGPRTAALGLLLLCAAAAGAGKAEELHYPLGERRSDYDREALLGVQEDVDEYVKLGHE
EQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNSDDTVTWD
EYNIQMYDRVIDFDENTALDDAEEESFRKEFAICKKHSFCFWLLRFNLHLKDKKRFEKAN
QDSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLGDYRWDPTAN
EDPEWILVEKDRFVNDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKK
LSEEEILENPDLFLTSEATDYGRQLHDDYFYHDEL
Download sequence
Identical sequences G3S551
ENSGGOP00000028006 ENSGGOP00000023206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]