SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028007 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028007
Domain Number 1 Region: 240-515
Classification Level Classification E-value
Superfamily SPOC domain-like 3.34e-71
Family Ku70 subunit middle domain 0.00000000113
Further Details:      
 
Domain Number 2 Region: 31-240
Classification Level Classification E-value
Superfamily vWA-like 8e-48
Family Ku70 subunit N-terminal domain 0.0000000204
Further Details:      
 
Domain Number 3 Region: 538-582
Classification Level Classification E-value
Superfamily SAP domain 0.000000403
Family SAP domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028007   Gene: ENSGGOG00000027167   Transcript: ENSGGOT00000027871
Sequence length 583
Comment pep:novel chromosome:gorGor3.1:X:96947640:96949450:-1 gene:ENSGGOG00000027167 transcript:ENSGGOT00000027871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSGWESYYKTEGDEEAEEEEDLEKYSGSDSLFLVDASRAMFESQSEGELTPFDMSIQCIQ
SVYMNKIISSDRDLYDTEKDRNSVNFKNIYILQELENPGAKQILKRDQFKGQQGQKCFED
LMGHGSDYSFSEVLWVCAKLFSDIQFKMSHKKIMLLTNEDNPHGSNSVKACRARTKAGDL
RDIGIFLDLMPLKKPGGFDISLFYRDIISMAKDEDLNPVHFEESSKLEDLLQKVRAKETR
LKLKLNKDIVISVGIYNLVQKALKPPSIKLYRKTNEPVKTKSQKFNINTGSLLLPSDTKR
SQIYGSHQIILEKEETEELKWFDEPALMLMVFKPLVMLKEHHYLRPSLFTYPEESPVNGS
STLFSALLIKCLEKVVIALCRYTPRRNIPPYFVALVSQEEELDDQKIQVTTPGFQLVFSP
FADDKRKVPFTEKVMATPEQVDNMKAIIQKLCFTYRSDSFENPMLQQHFGNLEPLILYLM
DPEQAVDLILPKVEEMNKRLGSMVNEFKELVYSPDYNPEGKITKRKRNNKQKAQVEYSEE
ELKTHISKGTLGKFTVPMMKEACLEYWLKKQELLEALTKHFQD
Download sequence
Identical sequences ENSGGOP00000028007 ENSGGOP00000028007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]