SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028018 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028018
Domain Number 1 Region: 9-44
Classification Level Classification E-value
Superfamily SAP domain 0.000000145
Family SAP domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028018   Gene: ENSGGOG00000013217   Transcript: ENSGGOT00000031995
Sequence length 210
Comment pep:known_by_projection chromosome:gorGor3.1:12:53821268:53868567:-1 gene:ENSGGOG00000013217 transcript:ENSGGOT00000031995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAATVILKYLELAELKQECLARGLETKGIKQDLIHRLQAYLEEHAEEEANEEDVLGDET
EEEETKPIELPVKEEEPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSLESKK
AARAARFGISSVPTKGLSSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKER
FGIVTSSAGTGTTEDTEAKKRKRAERFGIA
Download sequence
Identical sequences ENSGGOP00000028018 ENSGGOP00000028018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]