SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028022 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028022
Domain Number 1 Region: 97-315
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.86e-78
Family Leukotriene A4 hydrolase catalytic domain 0.00066
Further Details:      
 
Domain Number 2 Region: 2-90
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 0.000000549
Family Leukotriene A4 hydrolase N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028022   Gene: ENSGGOG00000027359   Transcript: ENSGGOT00000022875
Sequence length 316
Comment pep:novel chromosome:gorGor3.1:5:45977900:46023467:1 gene:ENSGGOG00000027359 transcript:ENSGGOT00000022875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRQATNQIVMNCADIDIITASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTNVIDRK
PYPDDENLVEVKFARTPVTSTYLVAFVVGEYDFVETRSKDGVCVRVYTPVGKAEQGKFAL
EVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWDLVTYRETALLIDPKNSCSSS
RQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVSA
DYTRAQELDALDNSHPIEVSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMN
MYLTKFQQKNAATGNL
Download sequence
Identical sequences ENSGGOP00000028022 ENSGGOP00000028022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]