SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028049 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028049
Domain Number 1 Region: 366-532,588-741
Classification Level Classification E-value
Superfamily L domain-like 1.07e-45
Family Ngr ectodomain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 140-344
Classification Level Classification E-value
Superfamily L domain-like 7.23e-35
Family Ngr ectodomain-like 0.00021
Further Details:      
 
Domain Number 3 Region: 1010-1200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-28
Family Laminin G-like module 0.0098
Further Details:      
 
Domain Number 4 Region: 1-109
Classification Level Classification E-value
Superfamily L domain-like 8.16e-27
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 5 Region: 861-902
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000686
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 6 Region: 781-822
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000195
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 7 Region: 938-979
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000372
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 824-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 9 Region: 903-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000545
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 1196-1237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000125
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028049   Gene: ENSGGOG00000006151   Transcript: ENSGGOT00000031243
Sequence length 1395
Comment pep:known_by_projection chromosome:gorGor3.1:4:20505120:20656436:1 gene:ENSGGOG00000006151 transcript:ENSGGOT00000031243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSV
ASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPSHLRGHNVAEVQK
REFVCSGHQSFMAPSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTI
KIIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLSFYGNKCPEPPKSLFEGLF
SLQLLLLTVTNLLKVLSIKALKKIFFLSLYNNTLQTIAKGTFSPLRAIQTMHLAQNPFIC
DCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRS
KLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIF
KKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLR
SNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAW
LGEWLRKKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPTECTCL
DTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTLSN
QSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHL
AIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPVDVN
ILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHL
KEGEEDGFWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCE
EKLDFCAQDLNPCQHDSKCILTPKGFKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDA
VNGYTCICPEGYSGLFCEFSPPMVLPRTSPCDNFDCQNGAQCIVRINEPICQCLPGYQGE
KCEKLVSVNFINKESYLQIPSAKVRPQTNITLQGVVKESLSILIRTQKDAMHYIYLLRGQ
DEASFNSRAEASSCLSCSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITNLSKQSTL
NFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQKVPMQTGILPGC
EPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCFSQVDLFWHGFCF
VCPRDETRGTCPSDVSFLNYILHTGCKNRRCVFFFLFCNLIICKASYEGEAKASEEISCR
GERIRDYYQKQQGYAACQTTKKVSRLECRGGCAGGQCCGPLRSKRRKYSFECTDGSSFVD
EVEKVVKCGCTRCVS
Download sequence
Identical sequences ENSGGOP00000028049 ENSGGOP00000006033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]